Lineage for d1bsfa_ (1bsf A:)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1923787Fold d.117: Thymidylate synthase/dCMP hydroxymethylase [55830] (1 superfamily)
    contains large mixed beta-sheet
  4. 1923788Superfamily d.117.1: Thymidylate synthase/dCMP hydroxymethylase [55831] (2 families) (S)
    automatically mapped to Pfam PF00303
  5. 1923789Family d.117.1.1: Thymidylate synthase/dCMP hydroxymethylase [55832] (4 proteins)
  6. 1923827Protein Thymidylate synthase [55833] (7 species)
  7. 1923828Species Bacillus subtilis [TaxId:1423] [55836] (5 PDB entries)
  8. 1923833Domain d1bsfa_: 1bsf A: [41033]

Details for d1bsfa_

PDB Entry: 1bsf (more details), 2.2 Å

PDB Description: thermostable thymidylate synthase a from bacillus subtilis
PDB Compounds: (A:) thymidylate synthase a

SCOPe Domain Sequences for d1bsfa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bsfa_ d.117.1.1 (A:) Thymidylate synthase {Bacillus subtilis [TaxId: 1423]}
tqfdkqynsiikdiinngisdeefdvrtkwdsdgtpahtlsviskqmrfdnsevpilttk
kvawktaikellwiwqlksndvndlnmmgvhiwdqwkqedgtighaygfqlgkknrslng
ekvdqvdyllhqlknnpssrrhitmlwnpdeldamaltpcvyetqwyvkhgklhlevrar
sndmalgnpfnvfqynvlqrmiaqvtgyelgeyifnigdchvytrhidnlkiqmereqfe
apelwinpevkdfydftiddfklinykhgdkllfevav

SCOPe Domain Coordinates for d1bsfa_:

Click to download the PDB-style file with coordinates for d1bsfa_.
(The format of our PDB-style files is described here.)

Timeline for d1bsfa_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1bsfb_