SCOPe 2.06: Domain d1tvva_: 1tvv A:

Lineage for d1tvva_ (1tvv A:)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.117: Thymidylate synthase/dCMP hydroxymethylase [55830] (1 superfamily)
   contains large mixed beta-sheet

4. Superfamily d.117.1: Thymidylate synthase/dCMP hydroxymethylase [55831] (2 families)
   automatically mapped to Pfam PF00303

5. Family d.117.1.1: Thymidylate synthase/dCMP hydroxymethylase [55832] (4 proteins)

6. Protein Thymidylate synthase [55833] (7 species)

7. Species Lactobacillus casei [TaxId:1582] [55835] (51 PDB entries)

8. Domain d1tvva_: 1tvv A: [40998]
   complexed with cb3, ump; mutant

Details for d1tvva_

PDB Entry: 1tvv, 2.3 Å

PDB Description: contributions of orientation and hydrogen bonding to catalysis in asn- 229 mutants of thymidylate synthase

PDB Compounds: (A:) Thymidylate synthase

SCOPe Domain Sequences for d1tvva_:

Sequence; same for both SEQRES and ATOM records:

>d1tvva_ d.117.1.1 (A:) Thymidylate synthase {Lactobacillus casei [TaxId: 1582]}
mleqpyldlakkvldeghfkpdrthtgtysifghqmrfdlskgfpllttkkvpfglikse
llwflhgdtnirfllqhrnhiwdewafekwvksdeyhgpdmtdfghrsqkdpefaavyhe
emakfddrvlhddafaakygdlglvygsqwrawhtskgdtidqlgdvieqikthpysrrl
ivsawnpedvptmalppchtlyqfyvndgklslqlyqrsadiflgvpfciasyallthlv
ahecglevgefihtfgdahlyvnhldqikeqlsrtprpaptlqlnpdkhdifdfdmkdik
llnydpypaikapvav

Timeline for d1tvva_:

• d1tvva_ first appeared (with stable ids) in SCOP 1.55, called d1tvv__
  
• d1tvva_ appears in SCOPe 2.05
  
• d1tvva_ appears in SCOPe 2.07
  
• d1tvva_ appears in the current release, SCOPe 2.08