Lineage for d4qqaa3 (4qqa A:1-359)

  1. Root: SCOPe 2.08
  2. 3021034Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)
  3. 3029423Fold f.69: Perfringolysin N-terminal-like [418706] (1 superfamily)
    twisted 4-strand antiparallel beta sheet, surrounded by other helices and strands, complex topology
  4. 3029424Superfamily f.69.1: Perfringolysin N-terminal-like [418735] (2 families) (S)
  5. 3029425Family f.69.1.1: Perfringolysin N-terminal-like [418783] (9 proteins)
  6. 3029453Protein Pneumolysin N-terminal domain [419172] (1 species)
  7. 3029454Species Pneumococcus (Streptococcus pneumoniae) [TaxId:1313] [419283] (7 PDB entries)
  8. 3029461Domain d4qqaa3: 4qqa A:1-359 [409382]
    Other proteins in same PDB: d4qqaa2, d4qqaa4

Details for d4qqaa3

PDB Entry: 4qqa (more details), 2.8 Å

PDB Description: crystal structure of pneumolysin from streptococcus pneumoniae
PDB Compounds: (A:) Pneumolysin

SCOPe Domain Sequences for d4qqaa3:

Sequence; same for both SEQRES and ATOM records: (download)

>d4qqaa3 f.69.1.1 (A:1-359) Pneumolysin N-terminal domain {Pneumococcus (Streptococcus pneumoniae) [TaxId: 1313]}
mankavndfilamnydkkkllthqgesienrfikegnqlpdefvvierkkrslstntsdi
svtatndsrlypgallvvdetllennptllavdrapmtysidlpglassdsflqvedpsn
ssvrgavndllakwhqdygqvnnvparmqyekitahsmeqlkvkfgsdfektgnsldidf
nsvhsgekqiqivnfkqiyytvsvdavknpgdvfqdtvtvedlkqrgisaerplvyissv
aygrqvylklettsksdeveaafealikgvkvapqtewkqildntevkavilggdpssga
rvvtgkvdmvedliqegsrftadhpglpisyttsflrdnvvatfqnstdyvetkvtayr

SCOPe Domain Coordinates for d4qqaa3:

Click to download the PDB-style file with coordinates for d4qqaa3.
(The format of our PDB-style files is described here.)

Timeline for d4qqaa3:

  • d4qqaa3 is new in SCOPe 2.08-stable