Lineage for d1axwa_ (1axw A:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2212073Fold d.117: Thymidylate synthase/dCMP hydroxymethylase [55830] (1 superfamily)
    contains large mixed beta-sheet
  4. 2212074Superfamily d.117.1: Thymidylate synthase/dCMP hydroxymethylase [55831] (2 families) (S)
    automatically mapped to Pfam PF00303
  5. 2212075Family d.117.1.1: Thymidylate synthase/dCMP hydroxymethylase [55832] (4 proteins)
  6. 2212113Protein Thymidylate synthase [55833] (7 species)
  7. 2212128Species Escherichia coli [TaxId:562] [55834] (67 PDB entries)
  8. 2212157Domain d1axwa_: 1axw A: [40938]
    complexed with mtx, ump

Details for d1axwa_

PDB Entry: 1axw (more details), 1.7 Å

PDB Description: e. coli thymidylate synthase in complex with methotrexate (mtx) and 2'-deoxyuridine 5'-monophosphate (dump)
PDB Compounds: (A:) Thymidylate synthase

SCOPe Domain Sequences for d1axwa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1axwa_ d.117.1.1 (A:) Thymidylate synthase {Escherichia coli [TaxId: 562]}
mkqylelmqkvldegtqkndrtgtgtlsifghqmrfnlqdgfplvttkrchlrsiihell
wflqgdtniaylhennvtiwdewadengdlgpvygkqwrawptpdgrhidqittvlnqlk
ndpdsrriivsawnvgeldkmalapchaffqfyvadgklscqlyqrscdvflglpfnias
yallvhmmaqqcdlevgdfvwtggdthlysnhmdqthlqlsreprplpkliikrkpesif
dyrfedfeiegydphpgikapvai

SCOPe Domain Coordinates for d1axwa_:

Click to download the PDB-style file with coordinates for d1axwa_.
(The format of our PDB-style files is described here.)

Timeline for d1axwa_: