Lineage for d1usha1 (1ush A:363-550)
- Root: SCOPe 2.08
Class d: Alpha and beta proteins (a+b) [53931] (396 folds) 
Fold d.114: 5'-nucleotidase (syn. UDP-sugar hydrolase), C-terminal domain [55815] (1 superfamily)
core: alpha-beta(2)-alpha-beta(2)-alpha-beta; 3 layers; mixed sheet: order 31425Superfamily d.114.1: 5'-nucleotidase (syn. UDP-sugar hydrolase), C-terminal domain [55816] (2 families) 
Family d.114.1.1: 5'-nucleotidase (syn. UDP-sugar hydrolase), C-terminal domain [55817] (1 protein) Protein 5'-nucleotidase (syn. UDP-sugar hydrolase), C-terminal domain [55818] (3 species) Species Escherichia coli [TaxId:562] [55819] (8 PDB entries)
Uniprot P07024 26-550
Domain d1usha1: 1ush A:363-550 [40923]
Other proteins in same PDB: d1usha2
complexed with co3, so4, zn
Details for d1usha1
PDB Entry: 1ush (more details), 1.73 Å
PDB Description: 5'-nucleotidase from e. coli
PDB Compounds: (A:) 5'-nucleotidaseSCOPe Domain Sequences for d1usha1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1usha1 d.114.1.1 (A:363-550) 5'-nucleotidase (syn. UDP-sugar hydrolase), C-terminal domain {Escherichia coli [TaxId: 562]}
kigetngrlegdrdkvrfvqtnmgrlilaaqmdrtgadfavmsgggirdsieagdisykn
vlkvqpfgnvvvyadmtgkevidyltavaqmkpdsgaypqfanvsfvakdgklndlkikg
epvdpaktyrmatlnfnatggdgyprldnkpgyvntgfidaevlkayiqksspldvsvye
pkgevswq
SCOPe Domain Coordinates for d1usha1:
Click to download the PDB-style file with coordinates for d1usha1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1usha1:
- d1usha1 first appeared (with stable ids) in SCOP 1.55, called d1ush_1
- d1usha1 appears in SCOPe 2.07
View in 3D
