SCOPe 2.05: Domain d1cfea_: 1cfe A:

Lineage for d1cfea_ (1cfe A:)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.111: PR-1-like [55796] (1 superfamily)
   alpha-beta-alpha-beta-alpha(2)-beta(2); 3 layers, alpha/beta/alpha; mixed sheet: order 1342

4. Superfamily d.111.1: PR-1-like [55797] (2 families)

5. Family d.111.1.1: PR-1-like [55798] (5 proteins)
   Pfam PF00188; groups mammalian SCP/TPX1; insects AG3/AG5; fungi SC7/SC14 and plant PR-1

6. Protein Pathogenesis-related protein 1 (PR1) [55799] (1 species)

7. Species Tomato (Lycopersicon esculentum), P14a [TaxId:4081] [55800] (1 PDB entry)

8. Domain d1cfea_: 1cfe A: [40913]

Details for d1cfea_

PDB Entry: 1cfe

PDB Description: p14a, nmr, 20 structures

PDB Compounds: (A:) pathogenesis-related protein p14a

SCOPe Domain Sequences for d1cfea_:

Sequence; same for both SEQRES and ATOM records:

>d1cfea_ d.111.1.1 (A:) Pathogenesis-related protein 1 (PR1) {Tomato (Lycopersicon esculentum), P14a [TaxId: 4081]}
qnspqdylavhndaraqvgvgpmswdanlasraqnyansragdcnlihsgagenlakggg
dftgraavqlwvserpsynyatnqcvggkkcrhytqvvwrnsvrlgcgrarcnngwwfis
cnydpvgnwigqrpy

Timeline for d1cfea_:

• d1cfea_ first appeared (with stable ids) in SCOP 1.55, called d1cfe__
  
• d1cfea_ appears in SCOPe 2.04
  
• d1cfea_ appears in SCOPe 2.06
  
• d1cfea_ appears in the current release, SCOPe 2.08