Lineage for d2acga_ (2acg A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2970038Fold d.110: Profilin-like [55769] (10 superfamilies)
    core: 2 alpha-helices and 5-stranded antiparallel sheet: order 21543; 3 layers: alpha/beta/alpha
  4. 2970039Superfamily d.110.1: Profilin (actin-binding protein) [55770] (2 families) (S)
    alpha-beta(2)-alpha-beta(5)-alpha
  5. 2970040Family d.110.1.1: Profilin (actin-binding protein) [55771] (2 proteins)
    automatically mapped to Pfam PF00235
  6. 2970041Protein Profilin (actin-binding protein) [55772] (8 species)
  7. 2970042Species Acanthamoeba castellanii [TaxId:5755] [55776] (5 PDB entries)
  8. 2970047Domain d2acga_: 2acg A: [40886]

Details for d2acga_

PDB Entry: 2acg (more details), 2.5 Å

PDB Description: acanthamoeba castellanii profilin ii
PDB Compounds: (A:) profilin II

SCOPe Domain Sequences for d2acga_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2acga_ d.110.1.1 (A:) Profilin (actin-binding protein) {Acanthamoeba castellanii [TaxId: 5755]}
swqtyvdtnlvgtgavtqaaiighdgntwatsagfavspangaalanafkdatairsngf
elagtryvtiraddrsvygkkgsagvitvktskailigvynekiqpgtaanvvekladyl
igqgf

SCOPe Domain Coordinates for d2acga_:

Click to download the PDB-style file with coordinates for d2acga_.
(The format of our PDB-style files is described here.)

Timeline for d2acga_: