Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.109: Gelsolin-like [55752] (3 superfamilies) 3 layers: a/b/a; contains mixed beta-sheet |
Superfamily d.109.1: Actin depolymerizing proteins [55753] (3 families) |
Family d.109.1.1: Gelsolin-like [55754] (5 proteins) |
Protein Gelsolin [55759] (2 species) consists of six similar domains |
Species Human (Homo sapiens) [TaxId:9606] [55761] (47 PDB entries) Uniprot P20065 55-179 |
Domain d1yvng_: 1yvn G: [40849] Other proteins in same PDB: d1yvna1, d1yvna2 complexed with atp, ca, mg, so4; mutant |
PDB Entry: 1yvn (more details), 2.1 Å
SCOPe Domain Sequences for d1yvng_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1yvng_ d.109.1.1 (G:) Gelsolin {Human (Homo sapiens) [TaxId: 9606]} mvvehpeflkagkepglqiwrvekfdlvpvptnlygdfftgdayvilktvqlrngnlqyd lhywlgnecsqdesgaaaiftvqlddylngravqhrevqgfesatflgyfksglkykkgg vasgf
Timeline for d1yvng_: