Lineage for d1yvng_ (1yvn G:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2576227Fold d.109: Gelsolin-like [55752] (3 superfamilies)
    3 layers: a/b/a; contains mixed beta-sheet
  4. 2576228Superfamily d.109.1: Actin depolymerizing proteins [55753] (3 families) (S)
  5. 2576229Family d.109.1.1: Gelsolin-like [55754] (5 proteins)
  6. 2576230Protein Gelsolin [55759] (2 species)
    consists of six similar domains
  7. 2576247Species Human (Homo sapiens) [TaxId:9606] [55761] (47 PDB entries)
    Uniprot P20065 55-179
  8. 2576279Domain d1yvng_: 1yvn G: [40849]
    Other proteins in same PDB: d1yvna1, d1yvna2
    complexed with atp, ca, mg, so4; mutant

Details for d1yvng_

PDB Entry: 1yvn (more details), 2.1 Å

PDB Description: the yeast actin val 159 asn mutant complex with human gelsolin segment 1.
PDB Compounds: (G:) protein (gelsolin)

SCOPe Domain Sequences for d1yvng_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1yvng_ d.109.1.1 (G:) Gelsolin {Human (Homo sapiens) [TaxId: 9606]}
mvvehpeflkagkepglqiwrvekfdlvpvptnlygdfftgdayvilktvqlrngnlqyd
lhywlgnecsqdesgaaaiftvqlddylngravqhrevqgfesatflgyfksglkykkgg
vasgf

SCOPe Domain Coordinates for d1yvng_:

Click to download the PDB-style file with coordinates for d1yvng_.
(The format of our PDB-style files is described here.)

Timeline for d1yvng_: