![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies) 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest |
![]() | Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families) ![]() duplication contains two domains of this fold |
![]() | Family c.55.1.1: Actin/HSP70 [53068] (8 proteins) |
![]() | Protein Actin [53073] (10 species) |
![]() | Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [53077] (2 PDB entries) |
![]() | Domain d1yvna1: 1yvn A:4-146 [33451] Other proteins in same PDB: d1yvng_ complexed with atp, ca, mg, so4; mutant |
PDB Entry: 1yvn (more details), 2.1 Å
SCOPe Domain Sequences for d1yvna1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1yvna1 c.55.1.1 (A:4-146) Actin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} evaalvidngsgmckagfagddapravfpsivgrprhqgimvgmgqkdsyvgdeaqskrg iltlrypiehgivtnwddmekiwhhtfynelrvapeehpvllteapmnpksnrekmtqim fetfnvpafyvsiqavlslyssg
Timeline for d1yvna1: