Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
Fold d.104: Class II aaRS and biotin synthetases [55680] (1 superfamily) contains large mixed beta-sheet |
Superfamily d.104.1: Class II aaRS and biotin synthetases [55681] (5 families) |
Family d.104.1.1: Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain [55682] (16 proteins) |
Protein Phenyl-tRNA synthetase (PheRS) beta subunit, PheT, central domain [55703] (1 species) this domain is non-catalytic |
Species Thermus thermophilus [TaxId:274] [55704] (12 PDB entries) identical sequence to Thermus aquaticus, TaxId: 271 |
Domain d1pysb5: 1pys B:475-681 [40779] Other proteins in same PDB: d1pysa_, d1pysb1, d1pysb2, d1pysb3, d1pysb4, d1pysb6 complexed with mg |
PDB Entry: 1pys (more details), 2.9 Å
SCOPe Domain Sequences for d1pysb5:
Sequence; same for both SEQRES and ATOM records: (download)
>d1pysb5 d.104.1.1 (B:475-681) Phenyl-tRNA synthetase (PheRS) beta subunit, PheT, central domain {Thermus thermophilus [TaxId: 274]} alpaffpapdnrgveapyrkeqrlrevlsglgfqevytysfmdpedarrfrldpprllll nplapekaalrthlfpglvrvlkenldldrperallfevgrvfrereethlagllfgegv glpwakerlsgyfllkgylealfarlglafrveaqafpflhpgvsgrvlvegeevgflga lhpeiaqelelppvhlfelrlplpdkp
Timeline for d1pysb5: