SCOPe 2.08: Domain d6ze1a_: 6ze1 A:

Lineage for d6ze1a_ (6ze1 A:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.12: ABC transporter ATPase domain-like [52686] (25 proteins)
   there are two additional subdomains inserted into the central core that has a RecA-like topology
   missing some secondary structures that made up less than one-third of the common domain
   

6. Protein Cystic fibrosis transmembrane conductance regulator, CFTR, nucleotide-binding domain [102378] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [117543] (26 PDB entries)
   Uniprot P13569 389-671

8. Domain d6ze1a_: 6ze1 A: [407576]
   Other proteins in same PDB: d6ze1b1, d6ze1b2
   automated match to d2pzga_
   complexed with atp, edo, gol

Details for d6ze1a_

PDB Entry: 6ze1, 2.71 Å

PDB Description: human nbd1 of cftr in complex with nanobody g11a

PDB Compounds: (A:) Cystic fibrosis transmembrane conductance regulator

SCOPe Domain Sequences for d6ze1a_:

Sequence; same for both SEQRES and ATOM records:

>d6ze1a_ c.37.1.12 (A:) Cystic fibrosis transmembrane conductance regulator, CFTR, nucleotide-binding domain {Human (Homo sapiens) [TaxId: 9606]}
ngddslffsnfsllgtpvlkdinfkiergqllavagstgagktsllmmimgelepsegki
khsgrisfcpqfswimpgtikeniifgvsydeyryrsvikacqleediskfpekdntvlg
eggitlsggqrarislaravykdadlylldspfgyldvltekeifescvcklmanktril
vtskmehlkkadkililhegssyfygtfselqnlq

Timeline for d6ze1a_:

• d6ze1a_ first appeared in SCOPe 2.07