Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.58: Ferredoxin-like [54861] (62 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.26: GHMP Kinase, C-terminal domain [55060] (8 families) common fold is elaborated with additional secondary structures |
Family d.58.26.7: Galactokinase [103011] (2 proteins) |
Protein automated matches [362873] (1 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [362874] (16 PDB entries) |
Domain d6zfhd2: 6zfh D:217-392 [407447] Other proteins in same PDB: d6zfha1, d6zfhb1, d6zfhc1, d6zfhc3, d6zfhd1, d6zfhe1, d6zfhf1, d6zfhg1, d6zfhh1 automated match to d1wuua2 complexed with gal, qv2 |
PDB Entry: 6zfh (more details), 2.44 Å
SCOPe Domain Sequences for d6zfhd2:
Sequence, based on SEQRES records: (download)
>d6zfhd2 d.58.26.7 (D:217-392) automated matches {Human (Homo sapiens) [TaxId: 9606]} klavlitnsnvrhslasseypvrrrqceevaralgaaslrevqleeleaardlvskegfr rarhvvgeirrtaqaaaalrrgdyrafgrlmveshrslrddyevscpeldqlveaalavp gvygsrmtgggfggctvtlleasaaphamrhiqehyggtatfylsqaadgakvlcl
>d6zfhd2 d.58.26.7 (D:217-392) automated matches {Human (Homo sapiens) [TaxId: 9606]} klavlitnsnvrhseypvrrrqceevaralgaaslrevqleeleaardlvskegfrrarh vvgeirrtaqaaaalrrgdyrafgrlmveshrslrddyevscpeldqlveaalavpgvyg srmtgggfggctvtlleasaaphamrhiqehyggtatfylsqaadgakvlcl
Timeline for d6zfhd2: