Lineage for d1avv__ (1avv -)
- Root: SCOP 1.57
Class d: Alpha and beta proteins (a+b) [53931] (194 folds) 
Fold d.102: Regulatory factor Nef [55670] (1 superfamily) Superfamily d.102.1: Regulatory factor Nef [55671] (1 family) 
Family d.102.1.1: Regulatory factor Nef [55672] (1 protein) Protein Regulatory factor Nef [55673] (1 species) Species Human immunodeficiency virus type 1 [TaxId:11676] [55674] (4 PDB entries) 
Domain d1avv__: 1avv - [40703]
Details for d1avv__
PDB Entry: 1avv (more details), 3 Å
PDB Description: hiv-1 nef protein, unliganded core domain
SCOP Domain Sequences for d1avv__:
Sequence, based on SEQRES records: (download)
>d1avv__ d.102.1.1 (-) Regulatory factor Nef {Human immunodeficiency virus type 1}
vplrpmtykaavdlshflkekggleglihsqrrqdildlwiyhtqgyfpdwqnytpgpgv
rypltfgwcyklvpvepdkveeankgentsllhpvslhgmddperevlewrfdsrlafhh
varelhpeyf
Sequence, based on observed residues (ATOM records): (download)
>d1avv__ d.102.1.1 (-) Regulatory factor Nef {Human immunodeficiency virus type 1}
vplrpmtykaavdlshflkekggleglihsqrrqdildlwiyhtqgyfpdwqnytpgpgv
rypltfgwcyklvpevlewrfdsrlafhhvarelhpeyf
SCOP Domain Coordinates for d1avv__:
Click to download the PDB-style file with coordinates for d1avv__.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1avv__:
- d1avv__ first appeared (with stable ids) in SCOP 1.55
- d1avv__ appears in SCOP 1.59
- d1avv__ appears in the current release, SCOPe 2.08, called d1avva_
View in 3D