Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
Fold d.100: MbtH/L9 domain-like [55657] (2 superfamilies) beta(2)-alpha-beta-alpha; 3 layers: alpha/beta/alpha |
Superfamily d.100.1: L9 N-domain-like [55658] (3 families) |
Family d.100.1.1: Ribosomal protein L9 N-domain [55659] (1 protein) automatically mapped to Pfam PF01281 |
Protein Ribosomal protein L9 N-domain [55660] (3 species) |
Species Bacillus stearothermophilus [TaxId:1422] [55661] (5 PDB entries) |
Domain d1diva2: 1div A:1-55 [40693] Other proteins in same PDB: d1diva1 |
PDB Entry: 1div (more details), 2.6 Å
SCOPe Domain Sequences for d1diva2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1diva2 d.100.1.1 (A:1-55) Ribosomal protein L9 N-domain {Bacillus stearothermophilus [TaxId: 1422]} mkviflkdvkgkgkkgeiknvadgyannflfkqglaieatpanlkaleaqkqkeq
Timeline for d1diva2: