SCOPe 2.05: Domain d1diva2: 1div A:1-55

Lineage for d1diva2 (1div A:1-55)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.100: MbtH/L9 domain-like [55657] (2 superfamilies)
   beta(2)-alpha-beta-alpha; 3 layers: alpha/beta/alpha

4. Superfamily d.100.1: L9 N-domain-like [55658] (3 families)

5. Family d.100.1.1: Ribosomal protein L9 N-domain [55659] (1 protein)
   automatically mapped to Pfam PF01281

6. Protein Ribosomal protein L9 N-domain [55660] (3 species)

7. Species Bacillus stearothermophilus [TaxId:1422] [55661] (5 PDB entries)

8. Domain d1diva2: 1div A:1-55 [40693]
   Other proteins in same PDB: d1diva1

Details for d1diva2

PDB Entry: 1div, 2.6 Å

PDB Description: ribosomal protein l9

PDB Compounds: (A:) ribosomal protein l9

SCOPe Domain Sequences for d1diva2:

Sequence; same for both SEQRES and ATOM records:

>d1diva2 d.100.1.1 (A:1-55) Ribosomal protein L9 N-domain {Bacillus stearothermophilus [TaxId: 1422]}
mkviflkdvkgkgkkgeiknvadgyannflfkqglaieatpanlkaleaqkqkeq

Timeline for d1diva2:

• d1diva2 first appeared (with stable ids) in SCOP 1.55, called d1div_2
  
• d1diva2 appears in SCOPe 2.04
  
• d1diva2 appears in SCOPe 2.06
  
• d1diva2 appears in the current release, SCOPe 2.08