Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.99: Ribosomal protein L9 C-domain [55652] (1 superfamily) alpha-beta-alpha(2)-beta(2); 2 layers: alpha/beta |
Superfamily d.99.1: Ribosomal protein L9 C-domain [55653] (1 family) automatically mapped to Pfam PF03948 |
Family d.99.1.1: Ribosomal protein L9 C-domain [55654] (1 protein) |
Protein Ribosomal protein L9 C-domain [55655] (3 species) |
Species Bacillus stearothermophilus [TaxId:1422] [55656] (1 PDB entry) |
Domain d1diva1: 1div A:56-149 [40692] Other proteins in same PDB: d1diva2 |
PDB Entry: 1div (more details), 2.6 Å
SCOPe Domain Sequences for d1diva1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1diva1 d.99.1.1 (A:56-149) Ribosomal protein L9 C-domain {Bacillus stearothermophilus [TaxId: 1422]} rqaaeelanakklkeqlekltvtipakageggrlfgsitskqiaeslqaqhglkldkrki eladairalgytnvpvklhpevtatlkvhvteqk
Timeline for d1diva1: