Lineage for d1diva1 (1div A:56-149)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2573816Fold d.99: Ribosomal protein L9 C-domain [55652] (1 superfamily)
    alpha-beta-alpha(2)-beta(2); 2 layers: alpha/beta
  4. 2573817Superfamily d.99.1: Ribosomal protein L9 C-domain [55653] (1 family) (S)
    automatically mapped to Pfam PF03948
  5. 2573818Family d.99.1.1: Ribosomal protein L9 C-domain [55654] (1 protein)
  6. 2573819Protein Ribosomal protein L9 C-domain [55655] (3 species)
  7. 2573820Species Bacillus stearothermophilus [TaxId:1422] [55656] (1 PDB entry)
  8. 2573821Domain d1diva1: 1div A:56-149 [40692]
    Other proteins in same PDB: d1diva2

Details for d1diva1

PDB Entry: 1div (more details), 2.6 Å

PDB Description: ribosomal protein l9
PDB Compounds: (A:) ribosomal protein l9

SCOPe Domain Sequences for d1diva1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1diva1 d.99.1.1 (A:56-149) Ribosomal protein L9 C-domain {Bacillus stearothermophilus [TaxId: 1422]}
rqaaeelanakklkeqlekltvtipakageggrlfgsitskqiaeslqaqhglkldkrki
eladairalgytnvpvklhpevtatlkvhvteqk

SCOPe Domain Coordinates for d1diva1:

Click to download the PDB-style file with coordinates for d1diva1.
(The format of our PDB-style files is described here.)

Timeline for d1diva1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1diva2