PDB entry 1div

View 1div on RCSB PDB site
Description: ribosomal protein l9
Class: ribosomal protein
Keywords: ribosomal protein, rRNA-binding
Deposited on 1996-07-02, released 1997-01-11
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.217
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ribosomal protein l9
    Species: Geobacillus stearothermophilus [TaxId:1422]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1diva1, d1diva2

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1divA (A:)
    mkviflkdvkgkgkkgeiknvadgyannflfkqglaieatpanlkaleaqkqkeqrqaae
    elanakklkeqlekltvtipakageggrlfgsitskqiaeslqaqhglkldkrkielada
    iralgytnvpvklhpevtatlkvhvteqk