Lineage for d5sa8b2 (5sa8 B:191-346)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 3009981Fold d.294: EndoU-like [142876] (1 superfamily)
    comprises several helices and two three-stranded antiparallel beta-sheets; similar architecture to the RNase A-like fold (54075)
  4. 3009982Superfamily d.294.1: EndoU-like [142877] (3 families) (S)
    similarity to the RNase A-like superfamily (54076) extends to the active site location and architecture; the two structural cores of the RNase A and EndoU superfamilies are interrelated by a topological permutation - transposition of two pereferial beta-strands, suggesting possible distant homology of the two superfamilies (and their unification in a hyperfamily)
  5. 3009991Family d.294.1.2: Nsp15 C-terminal domain-like [142881] (2 proteins)
    PfamB PB001946
  6. 3010008Protein automated matches [384919] (1 species)
    not a true protein
  7. 3010009Species Severe acute respiratory syndrome coronavirus 2 [TaxId:2697049] [384920] (29 PDB entries)
  8. 3010043Domain d5sa8b2: 5sa8 B:191-346 [406894]
    Other proteins in same PDB: d5sa8a1, d5sa8a3, d5sa8b1, d5sa8b3
    automated match to d2h85a2
    complexed with jov

Details for d5sa8b2

PDB Entry: 5sa8 (more details), 2.3 Å

PDB Description: pandda analysis group deposition -- crystal structure of sars-cov-2 nendou in complex with z68299550
PDB Compounds: (B:) Uridylate-specific endoribonuclease

SCOPe Domain Sequences for d5sa8b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5sa8b2 d.294.1.2 (B:191-346) automated matches {Severe acute respiratory syndrome coronavirus 2 [TaxId: 2697049]}
etyftqsrnlqefkprsqmeidflelamdefieryklegyafehivygdfshsqlgglhl
liglakrfkespfeledfipmdstvknyfitdaqtgsskcvcsvidlllddfveiiksqd
lsvvskvvkvtidyteisfmlwckdghvetfypklq

SCOPe Domain Coordinates for d5sa8b2:

Click to download the PDB-style file with coordinates for d5sa8b2.
(The format of our PDB-style files is described here.)

Timeline for d5sa8b2: