Class a: All alpha proteins [46456] (290 folds) |
Fold a.137: Non-globular all-alpha subunits of globular proteins [48661] (14 superfamilies) not a true fold annotated by the SCOP(e) curators as 'not a true fold' |
Superfamily a.137.10: Stathmin [101494] (1 family) single long helix crosslinking four tubulin subunits automatically mapped to Pfam PF00836 |
Family a.137.10.1: Stathmin [101495] (2 proteins) |
Protein Stathmin 4 [101496] (3 species) |
Species Norway rat (Rattus norvegicus) [TaxId:10116] [101497] (186 PDB entries) |
Domain d5s5ve_: 5s5v E: [406586] Other proteins in same PDB: d5s5va1, d5s5va2, d5s5vb1, d5s5vb2, d5s5vc1, d5s5vc2, d5s5vd1, d5s5vd2, d5s5vf1, d5s5vf2, d5s5vf3 automated match to d4i55e_ complexed with acp, ca, gdp, gtp, hr8, mes, mg |
PDB Entry: 5s5v (more details), 2.7 Å
SCOPe Domain Sequences for d5s5ve_:
Sequence, based on SEQRES records: (download)
>d5s5ve_ a.137.10.1 (E:) Stathmin 4 {Norway rat (Rattus norvegicus) [TaxId: 10116]} mevielnkctsgqsfevilkppsfdgvpefnaslprrrdpsleeiqkkleaaeerrkyqe aellkhlaekrehereviqkaieennnfikmakeklaqkmesnkenreahlaamlerlqe kdkhaeevrknkelkeea
>d5s5ve_ a.137.10.1 (E:) Stathmin 4 {Norway rat (Rattus norvegicus) [TaxId: 10116]} mevielnkctsgqsfevilkppsdpsleeiqkkleaaeerrkyqeaellkhlaekreher eviqkaieennnfikmakeklaqkmesnkenreahlaamlerlqekdkhaeevrknkelk eea
Timeline for d5s5ve_: