Lineage for d7ooea2 (7ooe A:219-418)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2883383Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 2883384Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families) (S)
    duplication contains two domains of this fold
  5. 2884835Family c.55.1.0: automated matches [227137] (1 protein)
    not a true family
  6. 2884836Protein automated matches [226839] (64 species)
    not a true protein
  7. 2885406Species Plasmodium falciparum [TaxId:36329] [225582] (23 PDB entries)
  8. 2885457Domain d7ooea2: 7ooe A:219-418 [406300]
    automated match to d3fe1a2
    complexed with an2, cl, gol, jhj, pg4, po4

Details for d7ooea2

PDB Entry: 7ooe (more details), 2.37 Å

PDB Description: plasmodium falciparum hsp70-x chaperone nucleotide binding domain in complex with z321318226
PDB Compounds: (A:) Heat shock protein 70

SCOPe Domain Sequences for d7ooea2:

Sequence; same for both SEQRES and ATOM records: (download)

>d7ooea2 c.55.1.0 (A:219-418) automated matches {Plasmodium falciparum [TaxId: 36329]}
gkgeqnilifdlgggtfdvslltledgifevkatsgdthlggedfdnklvnfcvqdfkkk
nggkdvsknskslrrlrtqcekakrvlsssaqatievdslfdgidynvnitrakfeelcm
dqfrntlipvekvlkdakmdksqvheivlvggstripkiqqlikdffngkepckainpde
avaygaavqaailsgdqssa

SCOPe Domain Coordinates for d7ooea2:

Click to download the PDB-style file with coordinates for d7ooea2.
(The format of our PDB-style files is described here.)

Timeline for d7ooea2:

View in 3D
Domains from same chain:
(mouse over for more information)
d7ooea1