Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.78: ATC-like [53670] (2 superfamilies) consists of two similar domains related by pseudo dyad; duplication core: 3 layers, a/b/a, parallel beta-sheet of 4 strands, order 2134 |
Superfamily c.78.1: Aspartate/ornithine carbamoyltransferase [53671] (2 families) |
Family c.78.1.0: automated matches [227206] (1 protein) not a true family |
Protein automated matches [226938] (26 species) not a true protein |
Species Mycobacterium tuberculosis [TaxId:83332] [225288] (11 PDB entries) |
Domain d7noua1: 7nou A:2-143 [406014] Other proteins in same PDB: d7noua3, d7noub3, d7nouc3, d7noud3, d7noue3, d7nouf3 automated match to d2i6ua1 complexed with nmr, po4 |
PDB Entry: 7nou (more details), 1.98 Å
SCOPe Domain Sequences for d7noua1:
Sequence; same for both SEQRES and ATOM records: (download)
>d7noua1 c.78.1.0 (A:2-143) automated matches {Mycobacterium tuberculosis [TaxId: 83332]} irhflrdddlspaeqaevlelaaelkkdpvsrrplqgprgvavifdknstrtrfsfelgi aqlgghavvvdsgstqlgrdetlqdtakvlsryvdaivwrtfgqerldamasvatvpvin alsdefhpcqvladlqtiaerk
Timeline for d7noua1: