SCOPe 2.06: Domain d2plda1: 2pld A:6-102

Lineage for d2plda1 (2pld A:6-102)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.93: SH2-like [55549] (1 superfamily)
   3 layers: a/b/a; antiparallel beta-sheet of 5 strands is flanked by two helices

4. Superfamily d.93.1: SH2 domain [55550] (2 families)

5. Family d.93.1.1: SH2 domain [55551] (35 proteins)
   Pfam PF00017

6. Protein Phospholipase C-gamma-1 [55577] (2 species)

7. Species Cow (Bos taurus) [TaxId:9913] [55578] (3 PDB entries)

8. Domain d2plda1: 2pld A:6-102 [40521]
   Other proteins in same PDB: d2plda2, d2plda3

Details for d2plda1

PDB Entry: 2pld

PDB Description: nuclear magnetic resonance structure of an sh2 domain of phospholipase c-gamma1 complexed with a high affinity binding peptide

PDB Compounds: (A:) phospholipase c gamma-1, c-terminal sh2 domain

SCOPe Domain Sequences for d2plda1:

Sequence; same for both SEQRES and ATOM records:

>d2plda1 d.93.1.1 (A:6-102) Phospholipase C-gamma-1 {Cow (Bos taurus) [TaxId: 9913]}
heskewyhasltraqaehmlmrvprdgaflvrkrnepnsyaisfraegkikhcrvqqegq
tvmlgnsefdslvdlisyyekhplyrkmklrypinee

Timeline for d2plda1:

• d2plda1 first appeared (with stable ids) in SCOP 1.55, called d2plda_
  
• d2plda1 was called d2plda_ in SCOPe 2.05
  
• d2plda1 appears in SCOPe 2.07
  
• d2plda1 appears in the current release, SCOPe 2.08