Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.12: Phosphoenolpyruvate/pyruvate domain [51621] (8 families) |
Family c.1.12.7: Phosphoenolpyruvate mutase/Isocitrate lyase-like [88704] (4 proteins) forms a swapped dimer |
Protein automated matches [190974] (9 species) not a true protein |
Species Yeast (Candida albicans) [TaxId:5476] [405205] (1 PDB entry) |
Domain d7ebeb_: 7ebe B: [405206] automated match to d5e9ha_ complexed with fmt, mg |
PDB Entry: 7ebe (more details), 2.69 Å
SCOPe Domain Sequences for d7ebeb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d7ebeb_ c.1.12.7 (B:) automated matches {Yeast (Candida albicans) [TaxId: 5476]} pytpidiqkeeadfqkevaeikkwwseprwrktkriysaediakkrgtlkinhpssqqad klfkllekhdadktvsftfgaldpihvaqmakyldsiyvsgwqcsstastsnepspdlad ypmdtvpnkvehlwfaqlfhdrkqreerltlskeeraktpyidflrpiiadadtghggit aiikltkmfiergaagihiedqapgtkkcghmagkvlvpvqehinrlvairasadifgsn llavartdseaatlitstidhrdhyfiigatnpeagdlaalmaeaeskgiygnelaaies ewtkkaglklfheavideikngnysnkdalikkftdkvnplshtshkeakklakeltgkd iyfnwdvararegyyryqggtqcavmrgrafapyadliwmesalpdyaqakefadgvkaa vpdqwlaynlspsfnwnkampadeqetyikrlgklgyvwqfitlaglhttalavddfsnq ysqigmkaygqtvqqpeiekgvevvkhqkwsgatyidgllkmvsggvtstaamgqgvted
Timeline for d7ebeb_: