Lineage for d7e0kw_ (7e0k W:)

  1. Root: SCOPe 2.08
  2. 3021034Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)
  3. 3028373Fold f.43: Chlorophyll a-b binding protein [103510] (1 superfamily)
    membrane all-alpha fold; three transmembrane helices
  4. 3028374Superfamily f.43.1: Chlorophyll a-b binding protein [103511] (2 families) (S)
    duplication: contains two structural repeats
  5. 3028375Family f.43.1.1: Chlorophyll a-b binding protein [103512] (2 proteins)
  6. 3028388Protein automated matches [190507] (3 species)
    not a true protein
  7. 3028389Species Green alga (Chlamydomonas reinhardtii) [TaxId:3055] [377998] (5 PDB entries)
  8. 3028399Domain d7e0kw_: 7e0k W: [405188]
    Other proteins in same PDB: d7e0kv_
    automated match to d5xnl2_
    complexed with chl, cla, lhg, lmg, lut, nex, tpo, xat; mutant

Details for d7e0kw_

PDB Entry: 7e0k (more details), 3.09 Å

PDB Description: lhcii-2 in the state transition supercomplex psi-lhci-lhcii from the double phosphatase mutant pph1;pbcp of chlamydomonas reinhardti.
PDB Compounds: (W:) Chlorophyll a-b binding protein, chloroplastic

SCOPe Domain Sequences for d7e0kw_:

Sequence; same for both SEQRES and ATOM records: (download)

>d7e0kw_ f.43.1.1 (W:) automated matches {Green alga (Chlamydomonas reinhardtii) [TaxId: 3055]}
iewygpdrpkflgpfsegdtpayltgefpgdygwdtaglsadpetfkryreleliharwa
mlgalgcitpellakngipfgeavwfkagaqifaegglnylgnenlihaqsiiatlafqv
vvmglaeayranggplgegldplhpggafdplgladdpdtfaelkvkeikngrlamfsmf
gffvqaivtgkgpiqnlddhlanptavnafayatkftpsa

SCOPe Domain Coordinates for d7e0kw_:

Click to download the PDB-style file with coordinates for d7e0kw_.
(The format of our PDB-style files is described here.)

Timeline for d7e0kw_: