Lineage for d1a81i2 (1a81 I:138-262)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1661863Fold d.93: SH2-like [55549] (1 superfamily)
    3 layers: a/b/a; antiparallel beta-sheet of 5 strands is flanked by two helices
  4. 1661864Superfamily d.93.1: SH2 domain [55550] (2 families) (S)
  5. 1661865Family d.93.1.1: SH2 domain [55551] (35 proteins)
    Pfam PF00017
  6. 1662214Protein Syk tyrosine kinase [55575] (1 species)
  7. 1662215Species Human (Homo sapiens) [TaxId:9606] [55576] (3 PDB entries)
  8. 1662225Domain d1a81i2: 1a81 I:138-262 [40516]

Details for d1a81i2

PDB Entry: 1a81 (more details), 3 Å

PDB Description: crystal structure of the tandem sh2 domain of the syk kinase bound to a dually tyrosine-phosphorylated itam
PDB Compounds: (I:) syk kinase

SCOPe Domain Sequences for d1a81i2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1a81i2 d.93.1.1 (I:138-262) Syk tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]}
lqgqaleqaiisqkpqlekliattahekmpwfhgkisreeseqivligsktngkflirar
dnngsyalcllhegkvlhyridkdktgklsipegkkfdtlwqlvehysykadgllrvltv
pcqki

SCOPe Domain Coordinates for d1a81i2:

Click to download the PDB-style file with coordinates for d1a81i2.
(The format of our PDB-style files is described here.)

Timeline for d1a81i2: