Lineage for d7dieb_ (7die B:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2700837Fold a.25: Ferritin-like [47239] (6 superfamilies)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. 2700838Superfamily a.25.1: Ferritin-like [47240] (10 families) (S)
    contains bimetal-ion centre in the middle of the bundle
  5. 2703895Family a.25.1.0: automated matches [191307] (1 protein)
    not a true family
  6. 2703896Protein automated matches [190036] (60 species)
    not a true protein
  7. 2704492Species Mycoplasma penetrans [TaxId:272633] [404969] (1 PDB entry)
  8. 2704494Domain d7dieb_: 7die B: [405025]
    automated match to d1vlga_
    complexed with fe

Details for d7dieb_

PDB Entry: 7die (more details), 1.9 Å

PDB Description: crystal structure of m. penetrans ferritin
PDB Compounds: (B:) Ferritin

SCOPe Domain Sequences for d7dieb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d7dieb_ a.25.1.0 (B:) automated matches {Mycoplasma penetrans [TaxId: 272633]}
svfnkderimdlvskhynvelcaanlyfhlatvskalgydnvaaffvkmgsdkqsahmsr
lvkymmkvdsilkinqisvpelvsfetiqevldaalkmeskvresvknvteisllakdfe
tfermqwfvkdsiedleeisdvwtyvhspnvnlinienivgkkl

SCOPe Domain Coordinates for d7dieb_:

Click to download the PDB-style file with coordinates for d7dieb_.
(The format of our PDB-style files is described here.)

Timeline for d7dieb_: