Lineage for d1bfi__ (1bfi -)
- Root: SCOP 1.57
Class d: Alpha and beta proteins (a+b) [53931] (194 folds) 
Fold d.93: SH2-like [55549] (1 superfamily) Superfamily d.93.1: SH2 domain [55550] (1 family) 
Family d.93.1.1: SH2 domain [55551] (20 proteins) 
Protein Phosphatidylinositol 3-kinase, p85-alpha subunit [55569] (3 species) 
Species Cow (Bos taurus) [TaxId:9913] [55570] (5 PDB entries) 
Domain d1bfi__: 1bfi - [40499]
Details for d1bfi__
PDB Entry: 1bfi (more details)
PDB Description: solution structure of the c-terminal sh2 domain of the p85alpha regulatory subunit of phosphoinositide 3-kinase, nmr, 30 structures
SCOP Domain Sequences for d1bfi__:
Sequence; same for both SEQRES and ATOM records: (download)
>d1bfi__ d.93.1.1 (-) Phosphatidylinositol 3-kinase, p85-alpha subunit {Cow (Bos taurus)}
edlphhdektwnvgssnrnkaenllrgkrdgtflvresskqgcyacsvvvdgevkhcvin
ktatgygfaepynlysslkelvlhyqhtslvqhndslnvtlaypvyaqqrr
SCOP Domain Coordinates for d1bfi__:
Click to download the PDB-style file with coordinates for d1bfi__.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1bfi__:
- d1bfi__ first appeared (with stable ids) in SCOP 1.55
- d1bfi__ appears in SCOP 1.59
- d1bfi__ appears in the current release, SCOPe 2.08, called d1bfia_
View in 3D