Lineage for d1tzee_ (1tze E:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2965227Fold d.93: SH2-like [55549] (1 superfamily)
    3 layers: a/b/a; antiparallel beta-sheet of 5 strands is flanked by two helices
  4. 2965228Superfamily d.93.1: SH2 domain [55550] (2 families) (S)
  5. 2965229Family d.93.1.1: SH2 domain [55551] (35 proteins)
    Pfam PF00017
  6. 2965387Protein Growth factor receptor-bound protein 2 (GRB2) [55563] (1 species)
  7. 2965388Species Human (Homo sapiens) [TaxId:9606] [55564] (38 PDB entries)
  8. 2965412Domain d1tzee_: 1tze E: [40468]

Details for d1tzee_

PDB Entry: 1tze (more details), 2.1 Å

PDB Description: signal transduction adaptor growth factor, grb2 sh2 domain complexed with phosphotyrosyl heptapeptide lys-pro-phe-ptyr-val-asn-val-nh2 (kfppyvnc-nh2)
PDB Compounds: (E:) Growth factor receptor-bound protein 2

SCOPe Domain Sequences for d1tzee_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1tzee_ d.93.1.1 (E:) Growth factor receptor-bound protein 2 (GRB2) {Human (Homo sapiens) [TaxId: 9606]}
mkphpwffgkiprakaeemlskqrhdgafliresesapgdfslsvkfgndvqhfkvlrdg
agkyflwvvkfnslnelvdyhrstsvsrnqqiflrdie

SCOPe Domain Coordinates for d1tzee_:

Click to download the PDB-style file with coordinates for d1tzee_.
(The format of our PDB-style files is described here.)

Timeline for d1tzee_: