Lineage for d1bkma_ (1bkm A:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2206459Fold d.93: SH2-like [55549] (1 superfamily)
    3 layers: a/b/a; antiparallel beta-sheet of 5 strands is flanked by two helices
  4. 2206460Superfamily d.93.1: SH2 domain [55550] (2 families) (S)
  5. 2206461Family d.93.1.1: SH2 domain [55551] (35 proteins)
    Pfam PF00017
  6. 2206478Protein c-src tyrosine kinase [55556] (3 species)
  7. 2206539Species Rous sarcoma virus [TaxId:11886] [69782] (12 PDB entries)
  8. 2206544Domain d1bkma_: 1bkm A: [40426]
    complexed with 1c5

Details for d1bkma_

PDB Entry: 1bkm (more details), 2 Å

PDB Description: cocrystal structure of d-amino acid substituted phosphopeptide complex
PDB Compounds: (A:) pp60 v-src tyrosine kinase transforming protein

SCOPe Domain Sequences for d1bkma_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bkma_ d.93.1.1 (A:) c-src tyrosine kinase {Rous sarcoma virus [TaxId: 11886]}
eewyfgkitrresealllnpenprgtflvresettkgayclsvsdfdnakglnvkhykir
kldsggfyitsrtqfsslqqlvayyskhadglchrltnvcpt

SCOPe Domain Coordinates for d1bkma_:

Click to download the PDB-style file with coordinates for d1bkma_.
(The format of our PDB-style files is described here.)

Timeline for d1bkma_: