Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.37: CBS-domain pair [54630] (1 superfamily) duplication: tandem repeat of two beta-X-beta-alpha-beta(2)-alpha motifs of similar sequences; 4 layers: a/b/b/a |
Superfamily d.37.1: CBS-domain pair [54631] (2 families) |
Family d.37.1.0: automated matches [191603] (1 protein) not a true family |
Protein automated matches [191100] (15 species) not a true protein |
Species Bacillus subtilis [TaxId:224308] [404144] (4 PDB entries) |
Domain d6yj8b_: 6yj8 B: [404194] automated match to d3lqna_ complexed with act, peg |
PDB Entry: 6yj8 (more details), 1.84 Å
SCOPe Domain Sequences for d6yj8b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6yj8b_ d.37.1.0 (B:) automated matches {Bacillus subtilis [TaxId: 224308]} leatvgqfmieadkvahvqvgnnlehallvltktgytaipvldpsyrlhgligtnmimns ifgleriefekldqitveevmltdiprlhindpimkgfgmvinngfvcvendeqvfegif trrvvlkelnkhi
Timeline for d6yj8b_: