![]() | Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
![]() | Fold d.93: SH2-like [55549] (1 superfamily) 3 layers: a/b/a; antiparallel beta-sheet of 5 strands is flanked by two helices |
![]() | Superfamily d.93.1: SH2 domain [55550] (2 families) ![]() |
![]() | Family d.93.1.1: SH2 domain [55551] (35 proteins) Pfam PF00017 |
![]() | Protein p56-lck tyrosine kinase [55552] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [55553] (11 PDB entries) |
![]() | Domain d1lkla_: 1lkl A: [40413] |
PDB Entry: 1lkl (more details), 1.8 Å
SCOPe Domain Sequences for d1lkla_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1lkla_ d.93.1.1 (A:) p56-lck tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} epepwffknlsrkdaerqllapgnthgsfliresestagsfslsvrdfdqnqgevvkhyk irnldnggfyispritfpglhelvrhytnasdglctrlsrpcqt
Timeline for d1lkla_: