PDB entry 1lkl

View 1lkl on RCSB PDB site
Description: human p56-lck tyrosine kinase sh2 domain in complex with the phosphotyrosyl peptide ac-ptyr-glu-glu-gly (pyeeg peptide)
Class: complex (tyrosine kinase/peptide)
Keywords: complex (tyrosine kinase/peptide)
Deposited on 1995-11-10, released 1996-03-08
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-04-28, with a file datestamp of 2009-04-24.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.189
AEROSPACI score: 0.51 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: human p56 tyrosine kinase
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1lkla_
  • Chain 'B':
    Compound: phosphotyrosyl peptide ac-ptyr-glu-glu-gly
    Database cross-references and differences (RAF-indexed):
    • PDB 1LKL (Start-3)
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1lklA (A:)
epepwffknlsrkdaerqllapgnthgsfliresestagsfslsvrdfdqnqgevvkhyk
irnldnggfyispritfpglhelvrhytnasdglctrlsrpcqt

  • Chain 'B':
    No sequence available.