Lineage for d7nz8a_ (7nz8 A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2918481Fold c.97: Cytidine deaminase-like [53926] (2 superfamilies)
    core: alpha-beta(2)-(alpha-beta)2; 3 layers (a/b/a); mixed beta-sheet of 4 strands, order 2134; strand 1 is antiparallel to the rest
  4. 2918482Superfamily c.97.1: Cytidine deaminase-like [53927] (7 families) (S)
    contains extra C-terminal strand 5, order 21345
  5. 2918813Family c.97.1.0: automated matches [191471] (1 protein)
    not a true family
  6. 2918814Protein automated matches [190746] (16 species)
    not a true protein
  7. 2918848Species Mouse (Mus musculus) [TaxId:10090] [403778] (3 PDB entries)
  8. 2918850Domain d7nz8a_: 7nz8 A: [403824]
    automated match to d2b3jd_
    protein/RNA complex; complexed with zn

Details for d7nz8a_

PDB Entry: 7nz8 (more details), 2.12 Å

PDB Description: crystal structure of mouse adat2/adat3 trna deamination complex 2
PDB Compounds: (A:) tRNA-specific adenosine deaminase 2

SCOPe Domain Sequences for d7nz8a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d7nz8a_ c.97.1.0 (A:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
pcvvsvqetekwmeeamrmakealenievpvgclmvynnevvgkgrnevnqtknatrhae
mvaidqvldwchqhgqspstvfehtvlyvtvepcimcaaalrlmkiplvvygcqnerfgg
cgsvlniasadlpntgrpfqcipgyraeeavellktfykqen

SCOPe Domain Coordinates for d7nz8a_:

Click to download the PDB-style file with coordinates for d7nz8a_.
(The format of our PDB-style files is described here.)

Timeline for d7nz8a_: