Lineage for d7no0a2 (7no0 A:151-229)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2706108Fold a.28: Acyl carrier protein-like [47335] (3 superfamilies)
    4 helices, bundle; helix 3 is shorter than others; up-and-down
  4. 2706465Superfamily a.28.3: Retrovirus capsid dimerization domain-like [47353] (3 families) (S)
  5. 2706557Family a.28.3.0: automated matches [191629] (1 protein)
    not a true family
  6. 2706558Protein automated matches [191156] (12 species)
    not a true protein
  7. 2706691Species Rous sarcoma virus (strain prague c) [TaxId:11888] [403735] (1 PDB entry)
  8. 2706692Domain d7no0a2: 7no0 A:151-229 [403736]
    Other proteins in same PDB: d7no0a1
    automated match to d1d1da1

Details for d7no0a2

PDB Entry: 7no0 (more details), 3.1 Å

PDB Description: structure of the mature rsv ca lattice: t=1 ca icosahedron
PDB Compounds: (A:) Capsid protein p27, alternate cleaved 1

SCOPe Domain Sequences for d7no0a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d7no0a2 a.28.3.0 (A:151-229) automated matches {Rous sarcoma virus (strain prague c) [TaxId: 11888]}
gpwadimqgpsesfvdfanrlikavegsdlppsarapviidcfrqksqpdiqqlirtaps
tlttpgeiikyvldrqkta

SCOPe Domain Coordinates for d7no0a2:

Click to download the PDB-style file with coordinates for d7no0a2.
(The format of our PDB-style files is described here.)

Timeline for d7no0a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d7no0a1