SCOPe 2.02: Domain d1bqob_: 1bqo B:

Lineage for d1bqob_ (1bqo B:)

1. Root: SCOPe 2.02

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.92: Zincin-like [55485] (2 superfamilies)
   contains mixed beta sheet with connection over free side of the sheet

4. Superfamily d.92.1: Metalloproteases ("zincins"), catalytic domain [55486] (18 families)

5. Family d.92.1.11: Matrix metalloproteases, catalytic domain [55528] (14 proteins)

6. Protein Stromelysin-1 (MMP-3) [55536] (1 species)

7. Species Human (Homo sapiens), fibroblast [TaxId:9606] [55537] (40 PDB entries)

8. Domain d1bqob_: 1bqo B: [40364]
   complexed with ca, n25, zn

Details for d1bqob_

PDB Entry: 1bqo, 2.3 Å

PDB Description: discovery of potent, achiral matrix metalloproteinase inhibitors

PDB Compounds: (B:) stromelysin-1

SCOPe Domain Sequences for d1bqob_:

Sequence; same for both SEQRES and ATOM records:

>d1bqob_ d.92.1.11 (B:) Stromelysin-1 (MMP-3) {Human (Homo sapiens), fibroblast [TaxId: 9606]}
frtfpgipkwrkthltyrivnytpdlpkdavdsavekalkvweevtpltfsrlyegeadi
misfavrehgdfypfdgpgnvlahayapgpgingdahfdddeqwtkdttgtnlflvaahe
ighslglfhsantealmyplyhsltdltrfrlsqddingiqslygpppdspet

Timeline for d1bqob_:

• d1bqob_ first appeared (with stable ids) in SCOP 1.55
  
• d1bqob_ appears in SCOPe 2.01
  
• d1bqob_ appears in SCOPe 2.03
  
• d1bqob_ appears in the current release, SCOPe 2.08