Lineage for d1buda_ (1bud A:)

  1. Root: SCOPe 2.01
  2. 1013083Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1034471Fold d.92: Zincin-like [55485] (2 superfamilies)
    contains mixed beta sheet with connection over free side of the sheet
  4. 1034472Superfamily d.92.1: Metalloproteases ("zincins"), catalytic domain [55486] (18 families) (S)
  5. 1034743Family d.92.1.9: Reprolysin-like [55519] (3 proteins)
    Pfam PF01421
  6. 1034748Protein Snake venom metalloprotease [55520] (7 species)
  7. 1034756Species Five-pace snake (Agkistrodon acutus), acutolysin A [TaxId:36307] [55523] (2 PDB entries)
  8. 1034757Domain d1buda_: 1bud A: [40328]
    complexed with ca, zn

Details for d1buda_

PDB Entry: 1bud (more details), 1.9 Å

PDB Description: acutolysin a from snake venom of agkistrodon acutus at ph 5.0
PDB Compounds: (A:) protein (acutolysin a)

SCOPe Domain Sequences for d1buda_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1buda_ d.92.1.9 (A:) Snake venom metalloprotease {Five-pace snake (Agkistrodon acutus), acutolysin A [TaxId: 36307]}
fqrymeivivvdhsmvkkyngdsdsikawvyemintitesysylkidislsgleiwsgkd
lidveasagntlksfgewrakdlihrishdnaqlltatdfdgatiglayvasmcnpkrsv
gviqdhssvnrlvaitlahemahnlgvshdegscscggkscimspsisdetikyfsdcsy
iqcrdyiskenppciln

SCOPe Domain Coordinates for d1buda_:

Click to download the PDB-style file with coordinates for d1buda_.
(The format of our PDB-style files is described here.)

Timeline for d1buda_: