SCOPe 2.05: Domain d1dthb_: 1dth B:

Lineage for d1dthb_ (1dth B:)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.92: Zincin-like [55485] (2 superfamilies)
   contains mixed beta sheet with connection over free side of the sheet

4. Superfamily d.92.1: Metalloproteases ("zincins"), catalytic domain [55486] (18 families)

5. Family d.92.1.9: Reprolysin-like [55519] (3 proteins)
   Pfam PF01421

6. Protein Snake venom metalloprotease [55520] (7 species)

7. Species Western diamonback rattlesnake (Crotalus atrox), atrolysin C [TaxId:8730] [55522] (3 PDB entries)

8. Domain d1dthb_: 1dth B: [40325]
   complexed with bat, ca, zn

Details for d1dthb_

PDB Entry: 1dth, 2 Å

PDB Description: metalloprotease

PDB Compounds: (B:) atrolysin c

SCOPe Domain Sequences for d1dthb_:

Sequence; same for both SEQRES and ATOM records:

>d1dthb_ d.92.1.9 (B:) Snake venom metalloprotease {Western diamonback rattlesnake (Crotalus atrox), atrolysin C [TaxId: 8730]}
qnlpqryielvvvadhrvfmkynsdlntirtrvheivnfingfyrslnihvsltdleiws
nedqiniqsassdtlnafaewretdllnrkshdnaqlltaieldeetlglaplgtmcdpk
lsigivqdhspinllmgvtmahelghnlgmehdgkdclrgaslcimrpgltkgrsyefsd
dsmhyyerflkqykpqcilnkp

Timeline for d1dthb_:

• d1dthb_ first appeared (with stable ids) in SCOP 1.55
  
• d1dthb_ appears in SCOPe 2.04
  
• d1dthb_ appears in SCOPe 2.06
  
• d1dthb_ appears in the current release, SCOPe 2.08