Lineage for d4aiga_ (4aig A:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2570195Fold d.92: Zincin-like [55485] (2 superfamilies)
    contains mixed beta sheet with connection over free side of the sheet
  4. 2570196Superfamily d.92.1: Metalloproteases ("zincins"), catalytic domain [55486] (18 families) (S)
  5. 2570750Family d.92.1.9: Reprolysin-like [55519] (3 proteins)
    Pfam PF01421
  6. 2570755Protein Snake venom metalloprotease [55520] (7 species)
  7. 2570758Species Eastern diamondback rattlesnake (Crotalus adamanteus), adamalysin II [TaxId:8729] [55521] (4 PDB entries)
  8. 2570759Domain d4aiga_: 4aig A: [40318]
    complexed with ca, flx, zn

Details for d4aiga_

PDB Entry: 4aig (more details), 2 Å

PDB Description: adamalysin ii with phosphonate inhibitor
PDB Compounds: (A:) adamalysin II

SCOPe Domain Sequences for d4aiga_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4aiga_ d.92.1.9 (A:) Snake venom metalloprotease {Eastern diamondback rattlesnake (Crotalus adamanteus), adamalysin II [TaxId: 8729]}
nlpqryielvvvadrrvfmkynsdlniirtrvheivniinefyrslnirvsltdleiwsg
qdfitiqssssntlnsfgewrervlltrkrhdnaqlltainfegkiigkaytssmcnprs
svgivkdhspinllvavtmahelghnlgmehdgkdclrgaslcimrpgltpgrsyefsdd
smgyyqkflnqykpqcilnkp

SCOPe Domain Coordinates for d4aiga_:

Click to download the PDB-style file with coordinates for d4aiga_.
(The format of our PDB-style files is described here.)

Timeline for d4aiga_: