Lineage for d4aig__ (4aig -)

  1. Root: SCOP 1.55
  2. 28523Class d: Alpha and beta proteins (a+b) [53931] (184 folds)
  3. 34307Fold d.92: Zincin-like [55485] (2 superfamilies)
  4. 34308Superfamily d.92.1: Metalloproteases ("zincins"), catalytic domain [55486] (11 families) (S)
  5. 34401Family d.92.1.9: Hemorrhagin [55519] (1 protein)
  6. 34402Protein Snake venom metalloprotease [55520] (4 species)
  7. 34405Species Eastern diamondback rattlesnake (Crotalus adamanteus), adamalysin II [TaxId:8729] [55521] (4 PDB entries)
  8. 34406Domain d4aig__: 4aig - [40318]

Details for d4aig__

PDB Entry: 4aig (more details), 2 Å

PDB Description: adamalysin ii with phosphonate inhibitor

SCOP Domain Sequences for d4aig__:

Sequence; same for both SEQRES and ATOM records: (download)

>d4aig__ d.92.1.9 (-) Snake venom metalloprotease {Eastern diamondback rattlesnake (Crotalus adamanteus), adamalysin II}
nlpqryielvvvadrrvfmkynsdlniirtrvheivniinefyrslnirvsltdleiwsg
qdfitiqssssntlnsfgewrervlltrkrhdnaqlltainfegkiigkaytssmcnprs
svgivkdhspinllvavtmahelghnlgmehdgkdclrgaslcimrpgltpgrsyefsdd
smgyyqkflnqykpqcilnkp

SCOP Domain Coordinates for d4aig__:

Click to download the PDB-style file with coordinates for d4aig__.
(The format of our PDB-style files is described here.)

Timeline for d4aig__: