SCOPe 2.05: Domain d1qjia_: 1qji A:

Lineage for d1qjia_ (1qji A:)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.92: Zincin-like [55485] (2 superfamilies)
   contains mixed beta sheet with connection over free side of the sheet

4. Superfamily d.92.1: Metalloproteases ("zincins"), catalytic domain [55486] (18 families)

5. Family d.92.1.8: Astacin [55516] (1 protein)
   automatically mapped to Pfam PF01400

6. Protein Astacin [55517] (1 species)

7. Species European fresh water crayfish (Astacus astacus) [TaxId:6715] [55518] (8 PDB entries)

8. Domain d1qjia_: 1qji A: [40315]
   complexed with pkf, zn

Details for d1qjia_

PDB Entry: 1qji, 2.14 Å

PDB Description: structure of astacin with a transition-state analogue inhibitor

PDB Compounds: (A:) astacin

SCOPe Domain Sequences for d1qjia_:

Sequence; same for both SEQRES and ATOM records:

>d1qjia_ d.92.1.8 (A:) Astacin {European fresh water crayfish (Astacus astacus) [TaxId: 6715]}
aailgdeylwsggvipytfagvsgadqsailsgmqeleektcirfvprttesdyveifts
gsgcwsyvgrisgaqqvslqangcvyhgtiihelmhaigfyhehtrmdrdnyvtinyqnv
dpsmtsnfdidtysryvgedyqyysimhygkysfsiqwgvletivplqngidltdpydka
hmlqtdanqinnlytnecsl

Timeline for d1qjia_:

• d1qjia_ first appeared (with stable ids) in SCOP 1.55
  
• d1qjia_ appears in SCOPe 2.04
  
• d1qjia_ appears in SCOPe 2.06
  
• d1qjia_ appears in the current release, SCOPe 2.08