Class b: All beta proteins [48724] (178 folds) |
Fold b.77: beta-Prism I [51091] (3 superfamilies) consists of 3 4-stranded sheets; strands are parallel to the 3-fold axis duplication: has internal pseudo threefold symmetry |
Superfamily b.77.2: delta-Endotoxin (insectocide), middle domain [51096] (2 families) |
Family b.77.2.0: automated matches [254290] (1 protein) not a true family |
Protein automated matches [254673] (3 species) not a true protein |
Species Bacillus thuringiensis [TaxId:1428] [255813] (7 PDB entries) |
Domain d6wpcc2: 6wpc C:277-483 [402685] Other proteins in same PDB: d6wpca1, d6wpca3, d6wpcb1, d6wpcb3, d6wpcc1, d6wpcc3, d6wpcd1, d6wpcd3 automated match to d1ciya2 |
PDB Entry: 6wpc (more details), 2.99 Å
SCOPe Domain Sequences for d6wpcc2:
Sequence; same for both SEQRES and ATOM records: (download)
>d6wpcc2 b.77.2.0 (C:277-483) automated matches {Bacillus thuringiensis [TaxId: 1428]} pirtvsqltreiytnpvlenfdgsfrgsaqgiersirsphlmdilnsitiytdahrgyyy wsghqimaspvgfsgpeftfplygtmgnaapqqrivaqlgqgvyrtlsstlyrrpfnigi nnqqlsvldgtefaygtssnlpsavyrksgtvdsldeippqnnnvpprqgfshrlshvsm frsgfsnssvsiirapmfswihrsaef
Timeline for d6wpcc2: