Lineage for d6wpcc2 (6wpc C:277-483)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2422560Fold b.77: beta-Prism I [51091] (3 superfamilies)
    consists of 3 4-stranded sheets; strands are parallel to the 3-fold axis
    duplication: has internal pseudo threefold symmetry
  4. 2422567Superfamily b.77.2: delta-Endotoxin (insectocide), middle domain [51096] (2 families) (S)
  5. 2422580Family b.77.2.0: automated matches [254290] (1 protein)
    not a true family
  6. 2422581Protein automated matches [254673] (3 species)
    not a true protein
  7. 2422582Species Bacillus thuringiensis [TaxId:1428] [255813] (7 PDB entries)
  8. 2422591Domain d6wpcc2: 6wpc C:277-483 [402685]
    Other proteins in same PDB: d6wpca1, d6wpca3, d6wpcb1, d6wpcb3, d6wpcc1, d6wpcc3, d6wpcd1, d6wpcd3
    automated match to d1ciya2

Details for d6wpcc2

PDB Entry: 6wpc (more details), 2.99 Å

PDB Description: crystal structure of bacillus thuringiensis cry1a.2 tryptic core variant
PDB Compounds: (C:) Cry1A.2

SCOPe Domain Sequences for d6wpcc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d6wpcc2 b.77.2.0 (C:277-483) automated matches {Bacillus thuringiensis [TaxId: 1428]}
pirtvsqltreiytnpvlenfdgsfrgsaqgiersirsphlmdilnsitiytdahrgyyy
wsghqimaspvgfsgpeftfplygtmgnaapqqrivaqlgqgvyrtlsstlyrrpfnigi
nnqqlsvldgtefaygtssnlpsavyrksgtvdsldeippqnnnvpprqgfshrlshvsm
frsgfsnssvsiirapmfswihrsaef

SCOPe Domain Coordinates for d6wpcc2:

Click to download the PDB-style file with coordinates for d6wpcc2.
(The format of our PDB-style files is described here.)

Timeline for d6wpcc2: