Lineage for d6wpca1 (6wpc A:53-276)

  1. Root: SCOPe 2.07
  2. 2626587Class f: Membrane and cell surface proteins and peptides [56835] (60 folds)
  3. 2626588Fold f.1: Toxins' membrane translocation domains [56836] (5 superfamilies)
    multi-helical domains of various folds which is thought to unfold in the membrane
  4. 2626637Superfamily f.1.3: delta-Endotoxin (insectocide), N-terminal domain [56849] (2 families) (S)
    automatically mapped to Pfam PF03945
  5. 2626661Family f.1.3.0: automated matches [254289] (1 protein)
    not a true family
  6. 2626662Protein automated matches [254672] (2 species)
    not a true protein
  7. 2626663Species Bacillus thuringiensis [TaxId:1428] [255812] (7 PDB entries)
  8. 2626670Domain d6wpca1: 6wpc A:53-276 [402680]
    Other proteins in same PDB: d6wpca2, d6wpca3, d6wpcb2, d6wpcb3, d6wpcc2, d6wpcc3, d6wpcd2, d6wpcd3
    automated match to d1ciya3

Details for d6wpca1

PDB Entry: 6wpc (more details), 2.99 Å

PDB Description: crystal structure of bacillus thuringiensis cry1a.2 tryptic core variant
PDB Compounds: (A:) Cry1A.2

SCOPe Domain Sequences for d6wpca1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6wpca1 f.1.3.0 (A:53-276) automated matches {Bacillus thuringiensis [TaxId: 1428]}
gntpidislsltqfllsefvpgagfvlglidliwgfvgpsqwdaflaqveqlinqriaea
vrntaiqelegmarvyrtyatafaewerapddpelrealrtqftatetyisgrisvlkiq
tfevqllsvfaqaanlhlsllrdvvffgqrwgfstttvnnyyndltegistytdyavrwy
ntglervwgpdsrdwvrynqfrreltltvldivalfpnydsrry

SCOPe Domain Coordinates for d6wpca1:

Click to download the PDB-style file with coordinates for d6wpca1.
(The format of our PDB-style files is described here.)

Timeline for d6wpca1: