Lineage for d6w57a2 (6w57 A:267-558)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2841004Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2841005Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2845793Family c.2.1.0: automated matches [191313] (1 protein)
    not a true family
  6. 2845794Protein automated matches [190069] (319 species)
    not a true protein
  7. 2849127Species Trypanosoma cruzi [TaxId:5693] [402627] (5 PDB entries)
  8. 2849129Domain d6w57a2: 6w57 A:267-558 [402630]
    Other proteins in same PDB: d6w57a1
    automated match to d2aw5a2
    complexed with epe, szg

Details for d6w57a2

PDB Entry: 6w57 (more details), 1.78 Å

PDB Description: trypanosoma cruzi malic enzyme in complex with inhibitor (mec069)
PDB Compounds: (A:) malic enzyme

SCOPe Domain Sequences for d6w57a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d6w57a2 c.2.1.0 (A:267-558) automated matches {Trypanosoma cruzi [TaxId: 5693]}
iqgtgaviaagflnaiklsgvsplqqrivvfgagsaavgvanniaalaarmykfpvqdlv
ktfylvdtkglvtttrgdqlaahkkllartdvsaedsaklrtleeivrfvkpttllglgg
vgpafteeivkmvmqnterpiifplsnptskaevtpenaykwtngaaivasgspfpptti
ggktfkpsqgnnlyvfpgvglgcalaqpthipeellltaseslnllttegdlregrlypp
ledihnisanvatdvileaqrmkidnnkklprtrdellafvkkamwkpvysg

SCOPe Domain Coordinates for d6w57a2:

Click to download the PDB-style file with coordinates for d6w57a2.
(The format of our PDB-style files is described here.)

Timeline for d6w57a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d6w57a1