Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) |
Family c.2.1.0: automated matches [191313] (1 protein) not a true family |
Protein automated matches [190069] (319 species) not a true protein |
Species Trypanosoma cruzi [TaxId:5693] [402627] (5 PDB entries) |
Domain d6w57a2: 6w57 A:267-558 [402630] Other proteins in same PDB: d6w57a1 automated match to d2aw5a2 complexed with epe, szg |
PDB Entry: 6w57 (more details), 1.78 Å
SCOPe Domain Sequences for d6w57a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d6w57a2 c.2.1.0 (A:267-558) automated matches {Trypanosoma cruzi [TaxId: 5693]} iqgtgaviaagflnaiklsgvsplqqrivvfgagsaavgvanniaalaarmykfpvqdlv ktfylvdtkglvtttrgdqlaahkkllartdvsaedsaklrtleeivrfvkpttllglgg vgpafteeivkmvmqnterpiifplsnptskaevtpenaykwtngaaivasgspfpptti ggktfkpsqgnnlyvfpgvglgcalaqpthipeellltaseslnllttegdlregrlypp ledihnisanvatdvileaqrmkidnnkklprtrdellafvkkamwkpvysg
Timeline for d6w57a2: