SCOP 1.63: Domain d1kuh__: 1kuh -

Lineage for d1kuh__ (1kuh -)

1. Root: SCOP 1.63

2. Class d: Alpha and beta proteins (a+b) [53931] (224 folds)

3. Fold d.92: Zincin-like [55485] (2 superfamilies)
   contains mixed beta sheet with connection over free side of the sheet

4. Superfamily d.92.1: Metalloproteases ("zincins"), catalytic domain [55486] (14 families)

5. Family d.92.1.1: Zinc protease [55487] (1 protein)
   single domain

6. Protein Zinc protease [55488] (1 species)

7. Species Streptomyces caespitosus [TaxId:53502] [55489] (2 PDB entries)

8. Domain d1kuh__: 1kuh - [40258]
   complexed with ca, zn

Details for d1kuh__

PDB Entry: 1kuh, 1.6 Å

PDB Description: zinc protease from streptomyces caespitosus

SCOP Domain Sequences for d1kuh__:

Sequence; same for both SEQRES and ATOM records:

>d1kuh__ d.92.1.1 (-) Zinc protease {Streptomyces caespitosus}
tvtvtydpsnapsfqqeianaaqiwnssvrnvqlraggnadfsyyegndsrgsyaqtdgh
grgyifldyqqnqqydstrvtahetghvlglpdhyqgpcselmsgggpgpsctnpypnaq
ersrvnalwang

Timeline for d1kuh__:

• d1kuh__ first appeared (with stable ids) in SCOP 1.55
  
• d1kuh__ appears in SCOP 1.61
  
• d1kuh__ appears in SCOP 1.65
  
• d1kuh__ appears in the current release, SCOPe 2.08, called d1kuha_