Lineage for d1kuh__ (1kuh -)

  1. Root: SCOP 1.61
  2. 187024Class d: Alpha and beta proteins (a+b) [53931] (212 folds)
  3. 194566Fold d.92: Zincin-like [55485] (2 superfamilies)
  4. 194567Superfamily d.92.1: Metalloproteases ("zincins"), catalytic domain [55486] (14 families) (S)
  5. 194568Family d.92.1.1: Zinc protease [55487] (1 protein)
  6. 194569Protein Zinc protease [55488] (1 species)
  7. 194570Species Streptomyces caespitosus [TaxId:53502] [55489] (2 PDB entries)
  8. 194572Domain d1kuh__: 1kuh - [40258]

Details for d1kuh__

PDB Entry: 1kuh (more details), 1.6 Å

PDB Description: zinc protease from streptomyces caespitosus

SCOP Domain Sequences for d1kuh__:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kuh__ d.92.1.1 (-) Zinc protease {Streptomyces caespitosus}
tvtvtydpsnapsfqqeianaaqiwnssvrnvqlraggnadfsyyegndsrgsyaqtdgh
grgyifldyqqnqqydstrvtahetghvlglpdhyqgpcselmsgggpgpsctnpypnaq
ersrvnalwang

SCOP Domain Coordinates for d1kuh__:

Click to download the PDB-style file with coordinates for d1kuh__.
(The format of our PDB-style files is described here.)

Timeline for d1kuh__: