Lineage for d7k78c_ (7k78 C:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2311419Fold a.22: Histone-fold [47112] (1 superfamily)
    core: 3 helices; long middle helix is flanked at each end with shorter ones
  4. 2311420Superfamily a.22.1: Histone-fold [47113] (5 families) (S)
  5. 2311421Family a.22.1.1: Nucleosome core histones [47114] (6 proteins)
    form octamers composed of two copies of each of the four histones
  6. 2312022Protein automated matches [193445] (8 species)
    not a true protein
  7. 2312074Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [256335] (7 PDB entries)
  8. 2312100Domain d7k78c_: 7k78 C: [402126]
    Other proteins in same PDB: d7k78k1, d7k78k2, d7k78l1, d7k78l2
    automated match to d1m1ac_
    protein/DNA complex

Details for d7k78c_

PDB Entry: 7k78 (more details), 3.1 Å

PDB Description: antibody and nucleosome complex
PDB Compounds: (C:) histone h2a.1

SCOPe Domain Sequences for d7k78c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d7k78c_ a.22.1.1 (C:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
asqsrsakagltfpvgrvhrllrrgnyaqrigsgapvyltavleylaaeilelagnaard
nkktriiprhlqlairnddelnkllgnvtiaqggvlpnihq

SCOPe Domain Coordinates for d7k78c_:

Click to download the PDB-style file with coordinates for d7k78c_.
(The format of our PDB-style files is described here.)

Timeline for d7k78c_: