Class a: All alpha proteins [46456] (289 folds) |
Fold a.22: Histone-fold [47112] (1 superfamily) core: 3 helices; long middle helix is flanked at each end with shorter ones |
Superfamily a.22.1: Histone-fold [47113] (5 families) |
Family a.22.1.1: Nucleosome core histones [47114] (6 proteins) form octamers composed of two copies of each of the four histones |
Protein automated matches [193445] (8 species) not a true protein |
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [256335] (7 PDB entries) |
Domain d7k78h_: 7k78 H: [402111] Other proteins in same PDB: d7k78k1, d7k78k2, d7k78l1, d7k78l2 automated match to d1s32d_ protein/DNA complex |
PDB Entry: 7k78 (more details), 3.1 Å
SCOPe Domain Sequences for d7k78h_:
Sequence; same for both SEQRES and ATOM records: (download)
>d7k78h_ a.22.1.1 (H:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]} rketyssyiykvlkqthpdtgisqksmsilnsfvndiferiateasklaaynkkstisar eiqtavrlilpgelakhavsegtravtkyssst
Timeline for d7k78h_: