Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.71: Dihydrofolate reductase-like [53596] (1 superfamily) 3 layers: a/b/a; mixed beta-sheet of 8 strands, order 34251687; strand 8 is antiparallel to the rest |
Superfamily c.71.1: Dihydrofolate reductase-like [53597] (3 families) |
Family c.71.1.0: automated matches [191485] (1 protein) not a true family |
Protein automated matches [190777] (27 species) not a true protein |
Species Mycobacteroides abscessus [TaxId:561007] [402107] (1 PDB entry) |
Domain d7k6ce_: 7k6c E: [402108] automated match to d3ghva_ complexed with ca, edo, mmv, nap |
PDB Entry: 7k6c (more details), 2 Å
SCOPe Domain Sequences for d7k6ce_:
Sequence; same for both SEQRES and ATOM records: (download)
>d7k6ce_ c.71.1.0 (E:) automated matches {Mycobacteroides abscessus [TaxId: 561007]} gtigliwaqtragvigadgaipwrlpedqarfkritmghtvimgrktweslpgsvrplpg rpnivltrdalfepdgalavgsadaalaasdeapwvigggeiyrlflplaqrcevtvvea dvpgdalapelgegwvvetndwqtsesglryqflsyrkv
Timeline for d7k6ce_: