Lineage for d3ghva_ (3ghv A:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2510888Fold c.71: Dihydrofolate reductase-like [53596] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 8 strands, order 34251687; strand 8 is antiparallel to the rest
  4. 2510889Superfamily c.71.1: Dihydrofolate reductase-like [53597] (3 families) (S)
  5. 2510890Family c.71.1.1: Dihydrofolate reductases [53598] (4 proteins)
  6. 2511215Protein Dihydrofolate reductases, eukaryotic type [53605] (7 species)
  7. 2511263Species Human (Homo sapiens) [TaxId:9606] [53607] (79 PDB entries)
  8. 2511269Domain d3ghva_: 3ghv A: [176654]
    automated match to d1drfa_
    complexed with ghc, gol, ndp, so4; mutant

Details for d3ghva_

PDB Entry: 3ghv (more details), 1.3 Å

PDB Description: human dihydrofolate reductase q35k/n64f double mutant inhibitor complex
PDB Compounds: (A:) dihydrofolate reductase

SCOPe Domain Sequences for d3ghva_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ghva_ c.71.1.1 (A:) Dihydrofolate reductases, eukaryotic type {Human (Homo sapiens) [TaxId: 9606]}
vgslncivavsqnmgigkngdlpwpplrnefryfkrmtttssvegkqnlvimgkktwfsi
pekfrplkgrinlvlsrelkeppqgahflsrslddalklteqpelankvdmvwivggssv
ykeamnhpghlklfvtrimqdfesdtffpeidlekykllpeypgvlsdvqeekgikykfe
vyeknd

SCOPe Domain Coordinates for d3ghva_:

Click to download the PDB-style file with coordinates for d3ghva_.
(The format of our PDB-style files is described here.)

Timeline for d3ghva_: