Lineage for d1bzla3 (1bzl A:358-487)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2962835Fold d.87: CO dehydrogenase flavoprotein C-domain-like [55423] (2 superfamilies)
    core: beta(3,4)-alpha(3); alpha+beta sandwich
  4. 2962836Superfamily d.87.1: FAD/NAD-linked reductases, dimerisation (C-terminal) domain [55424] (1 family) (S)
    both first two domains are of same beta/beta/alpha fold
  5. 2962837Family d.87.1.1: FAD/NAD-linked reductases, dimerisation (C-terminal) domain [55425] (11 proteins)
  6. 2962968Protein Trypanothione reductase [55429] (3 species)
  7. 2962987Species Trypanosoma cruzi [TaxId:5693] [55431] (4 PDB entries)
  8. 2962990Domain d1bzla3: 1bzl A:358-487 [40192]
    Other proteins in same PDB: d1bzla1, d1bzla2, d1bzlb1, d1bzlb2
    complexed with fad, gcg

Details for d1bzla3

PDB Entry: 1bzl (more details), 2.4 Å

PDB Description: crystal structure of trypanosoma cruzi trypanothione reductase in complex with trypanothione, and the structure-based discovery of new natural product inhibitors
PDB Compounds: (A:) trypanothione reductase (oxidized form)

SCOPe Domain Sequences for d1bzla3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bzla3 d.87.1.1 (A:358-487) Trypanothione reductase {Trypanosoma cruzi [TaxId: 5693]}
dhtrvasavfsippigtcglieevaskryevvavylssftplmhkvsgskyktfvakiit
nhsdgtvlgvhllgdnapeiiqgigiclklnakisdfyntigvhptsaeelcsmrtpsyy
yvkgekmekp

SCOPe Domain Coordinates for d1bzla3:

Click to download the PDB-style file with coordinates for d1bzla3.
(The format of our PDB-style files is described here.)

Timeline for d1bzla3: