Lineage for d7daff1 (7daf F:1-76)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2861871Fold c.30: PreATP-grasp domain [52439] (1 superfamily)
    3 layers: a/b/a; parallel or mixed beta-sheet of 4 to 6 strands
    possible rudiment form of Rossmann-fold domain
  4. 2861872Superfamily c.30.1: PreATP-grasp domain [52440] (10 families) (S)
    precedes the ATP-grasp domain common to all superfamily members, can contain a substrate-binding function
  5. 2862155Family c.30.1.9: Tubulin tyrosine ligase (TTL) N-terminal domain-like [310625] (1 protein)
  6. 2862156Protein Tubulin tyrosine ligase (TTL) N-terminal domain [310727] (2 species)
  7. 2862157Species Chicken (Gallus gallus) [TaxId:9031] [311384] (188 PDB entries)
  8. 2862219Domain d7daff1: 7daf F:1-76 [401915]
    Other proteins in same PDB: d7dafb1, d7dafb2, d7dafc1, d7dafc2, d7dafd1, d7dafd2, d7dafe_, d7daff2, d7daff3
    automated match to d3tiia1
    complexed with acp, ca, cl, gdp, gtp, gzx, mes, mg

Details for d7daff1

PDB Entry: 7daf (more details), 2.4 Å

PDB Description: ixa in complex with tubulin
PDB Compounds: (F:) tubulin tyrosine ligase

SCOPe Domain Sequences for d7daff1:

Sequence; same for both SEQRES and ATOM records: (download)

>d7daff1 c.30.1.9 (F:1-76) Tubulin tyrosine ligase (TTL) N-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]}
mytfvvrdenssvyaevsrlllatgqwkrlrkdnprfnlmlgernrlpfgrlghepglvq
lvnyyrgadklcrkas

SCOPe Domain Coordinates for d7daff1:

Click to download the PDB-style file with coordinates for d7daff1.
(The format of our PDB-style files is described here.)

Timeline for d7daff1: